Rabbit Polyclonal Anti-A2BP1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-A2BP1 antibody is: synthetic peptide directed towards the N-terminal region of Human A2BP1. Synthetic peptide located within the following region: NCEREQLRGNQEAAAAPDTMAQPYASAQFAPPQNGIPAEYTAPHPHPAPE |
Rabbit Polyclonal Anti-A2BP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-A2BP1 antibody: synthetic peptide directed towards the N terminal of human A2BP1. Synthetic peptide located within the following region: SAQTVSGTATQTDDAAPTDGQPQTQPSENTENKSQPKRLHVSNIPFRFRD |
Rabbit Polyclonal Anti-A2BP1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-A2BP1 antibody: synthetic peptide directed towards the middle region of human A2BP1. Synthetic peptide located within the following region: TAAAYSDRNQFVFVAADEISCNTSAVTDEFMLPTPTTTHLLQPPPTALVP |
Germany
Japan
United Kingdom
China
