Antibodies for $/€ 289

Jump to Filters
View as table Download
ZNF342 (ZNF296) Rabbit Polyclonal Antibody
TA345523

USD 475.00

5 Days

Rabbit Polyclonal Anti-ZNF342 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF342 antibody: synthetic peptide directed towards the C terminal of human ZNF342. Synthetic peptide located within the following region: YACAQSSKLNRHRRMHGMTPGSTRFECPHCHVPFGLRATLDKHLRQKHPE
ZNF342 (ZNF296) Rabbit Polyclonal Antibody
TA345522

USD 475.00

5 Days

Rabbit Polyclonal Anti-ZNF342 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF342 antibody: synthetic peptide directed towards the N terminal of human ZNF342. Synthetic peptide located within the following region: KLLRHAQWDHGLSIYQTESEAPEAPLLGLAEVAAAVSAVVGPAAEAKSPR