Rabbit Polyclonal Anti-RTCD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RTCD1 antibody: synthetic peptide directed towards the N terminal of human RTCD1. Synthetic peptide located within the following region: VQKIRAGRSTPGLRPQHLSGLEMIRDLCDGQLEGAEIGSTEITFTPEKIK |
Rabbit Polyclonal Anti-Rtcd1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Rtcd1 antibody is: synthetic peptide directed towards the middle region of Rat Rtcd1. Synthetic peptide located within the following region: QHLSGLEMVRDLCDGHLEGAEIGSTEITFTPEKIRGGVHTADTKTAGSVC |
Germany
Japan
United Kingdom
China
