Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Rabbit Polyclonal Anti-MAPK9 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Mapk9 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VCAAFDTVLGINVAVKKLSRPFQNQTHAKRAYRELVLLKCVNHKNIISLL |
Rabbit Polyclonal Anti-SHC3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Shc3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PSKMLSSILGKSNLQFAGMSISLTISTASLNLRTPDSKQIIANHHMRSIS |
Rabbit Polyclonal Anti-LAMB1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LAMB1 antibody: synthetic peptide directed towards the middle region of human LAMB1. Synthetic peptide located within the following region: VEELKRKAAQNSGEAEYIEKVVYTVKQSAEDVKKTLDGELDEKYKKVENL |
Germany
Japan
United Kingdom
China
