Rabbit Polyclonal Anti-LIPT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LIPT1 antibody: synthetic peptide directed towards the N terminal of human LIPT1. Synthetic peptide located within the following region: NCFQLLCNCQVPAAGFKKTVKNGLILQSISNDVYQNLAVEDWIHDHMNLE |
Rabbit Polyclonal Anti-LIAS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LIAS antibody: synthetic peptide directed towards the N terminal of human LIAS. Synthetic peptide located within the following region: LLQNGPDLQDFVSGDLADRSTWDEYKGNLKRQKGERLRLPPWLKTEIPMG |
Germany
Japan
United Kingdom
China