Antibodies for $/€ 289

Jump to Filters
View as table Download
ETV3L Rabbit Polyclonal Antibody
TA344516

USD 475.00

5 Days

Rabbit Polyclonal Anti-ETV3L Antibody - middle region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Etv3l antibody is: synthetic peptide directed towards the middle region of Rat Etv3l. Synthetic peptide located within the following region: HVIAWQQGEYGEFVIKDPDEVARLWGRRKCKPQMNYDKLSRALRYYYNKR