Antibodies for $/€ 289

Jump to Filters
View as table Download
Rex1 (ZFP42) Rabbit Polyclonal Antibody
TA345600

USD 475.00

5 Days

Rabbit Polyclonal Anti-ZFP42 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZFP42 antibody: synthetic peptide directed towards the middle region of human ZFP42. Synthetic peptide located within the following region: FNLRTHVRIHTGEKRFVCPFQGCNRRFIQSNNLKAHILTHANTNKNEQEG