Antibodies for $/€ 289

View as table Download

Rabbit Polyclonal Anti-CYP11B2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP11B2 antibody: synthetic peptide directed towards the middle region of human CYP11B2. Synthetic peptide located within the following region: RRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAI

Rabbit Polyclonal Anti-HSD11B2 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HSD11B2 antibody: synthetic peptide directed towards the N terminal of human HSD11B2. Synthetic peptide located within the following region: ERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRL