Antibodies for $/€ 289

Jump to Filters
View as table Download
SNAP23 Rabbit Polyclonal Antibody
TA346718

USD 475.00

5 Days

Rabbit Polyclonal Anti-SNAP23 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SNAP23 antibody: synthetic peptide directed towards the N terminal of human SNAP23. Synthetic peptide located within the following region: GIKTITMLDEQKEQLNRIEEGLDQINKDMRETEKTLTELNKCCGLCVCPC