Rabbit Polyclonal Anti-CAP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CAP1 antibody: synthetic peptide directed towards the N terminal of human CAP1. Synthetic peptide located within the following region: MADMQNLVERLERAVGRLEAVSHTSDMHRGYADSPSKAGAAPYVQAFDSL |
Rabbit Polyclonal Anti-CAP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CAP1 antibody: synthetic peptide directed towards the middle region of human CAP1. Synthetic peptide located within the following region: KAQSGPVRSGPKPFSAPKPQTSPSPKRATKKEPAVLELEGKKWRVENQEN |
Germany
Japan
United Kingdom
China