Rabbit Polyclonal Anti-CLEC4M Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLEC4M antibody: synthetic peptide directed towards the n terminal of human CLEC4M. Synthetic peptide located within the following region: MSDSKEPRVQQLGLLEEDPTTSGIRLFPRDFQFQQIHGHKSSTGCLGHGA |
Rabbit Polyclonal Anti-CLEC4M Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLEC4M antibody: synthetic peptide directed towards the middle region of human CLEC4M. Synthetic peptide located within the following region: NRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFS |
Germany
Japan
United Kingdom
China