Rabbit Polyclonal Anti-FBXO34 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FBXO34 antibody: synthetic peptide directed towards the middle region of human FBXO34. Synthetic peptide located within the following region: ESECLKRQGQREPGSLSRNNSFRRNVGRVLLANSTQADEGKTKKGVLEAP |
Rabbit Polyclonal Anti-FBXO34 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Fbxo34 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RDTLRTPMSHGKANGDVKARASYMKPTVLPSASLVKASSRKPFGILSPNV |
Germany
Japan
United Kingdom
China