Rabbit Polyclonal Anti-FBXW4 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Fbxw4 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: STFYCLQTDGNHLLATGSSYYGLVRLWDRRQRACLHAFPLTSTPLSSPVY |
Rabbit Polyclonal Anti-FBXW4 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FBXW4 antibody is: synthetic peptide directed towards the N-terminal region of Human FBXW4. Synthetic peptide located within the following region: RQMPWMQLEDDSLYISQANFILAYQFRPDGASLNRRPLGVFAGHDEDVCH |
Germany
Japan
United Kingdom
China