Antibodies for $/€ 289

Jump to Filters
View as table Download
ILF1 (FOXK2) Rabbit Polyclonal Antibody
TA345613

USD 475.00

5 Days

Rabbit Polyclonal Anti-FOXK2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXK2 antibody: synthetic peptide directed towards the middle region of human FOXK2. Synthetic peptide located within the following region: GTASRIIQTAQTTPVQTVTIVQQAPLGQHQLPIKTVTQNGTHVASVPTAV
ILF1 (FOXK2) Rabbit Polyclonal Antibody
TA345614

USD 475.00

5 Days

Rabbit Polyclonal Anti-FOXK2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXK2 antibody: synthetic peptide directed towards the C terminal of human FOXK2. Synthetic peptide located within the following region: DKQLTLNGIYTHITKNYPYYRTADKGWQRGESFAHVGNTRIRIGLPAHKA