Rabbit Polyclonal Anti-FST Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FST antibody: synthetic peptide directed towards the middle region of human FST. Synthetic peptide located within the following region: ALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCN |
Rabbit Polyclonal Anti-FST Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FST antibody: synthetic peptide directed towards the C terminal of human FST. Synthetic peptide located within the following region: SLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCN |
Germany
Japan
United Kingdom
China