Rabbit Polyclonal Anti-HIF1AN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HIF1AN antibody: synthetic peptide directed towards the N terminal of human HIF1AN. Synthetic peptide located within the following region: MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDP |
Rabbit Polyclonal Anti-HIF1AN Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HIF1AN antibody: synthetic peptide directed towards the middle region of human HIF1AN. Synthetic peptide located within the following region: GGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEV |
Germany
Japan
United Kingdom
China