Antibodies for $/€ 289

Jump to Filters
View as table Download
HNRPUL1 (HNRNPUL1) Rabbit Polyclonal Antibody
TA345996

USD 410.00

5 Days

Rabbit Polyclonal Anti-HNRPUL1 Antibody

Applications IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRPUL1 antibody: synthetic peptide directed towards the C terminal of human HNRPUL1. Synthetic peptide located within the following region: TYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNYDYGSYSGNTQGGTSTQ
HNRPUL1 (HNRNPUL1) Rabbit Polyclonal Antibody
TA345995

USD 475.00

5 Days

Rabbit Polyclonal Anti-HNRPUL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRPUL1 antibody: synthetic peptide directed towards the middle region of human HNRPUL1. Synthetic peptide located within the following region: LPDVGDFLDEVLFIELQREEADKLVRQYNEEGRKAGPPPEKRFDNRGGGG