Rabbit Polyclonal Anti-LANCL2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LANCL2 antibody: synthetic peptide directed towards the middle region of human LANCL2. Synthetic peptide located within the following region: EMVKPSIDYVRHKKFRSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYK |
Rabbit Polyclonal Anti-LANCL2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LANCL2 antibody: synthetic peptide directed towards the middle region of human LANCL2. Synthetic peptide located within the following region: LQLQRSVVCQESDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVV |
Germany
Japan
United Kingdom
China