Rabbit Polyclonal Anti-RAB5C Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAB5C antibody: synthetic peptide directed towards the middle region of human RAB5C. Synthetic peptide located within the following region: KTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCS |
Rabbit Polyclonal Anti-RAB5C Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rab5c antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSL |
Germany
Japan
United Kingdom
China