Rabbit Polyclonal Anti-JMJD6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-JMJD6 antibody: synthetic peptide directed towards the N terminal of human JMJD6. Synthetic peptide located within the following region: NHKSKKRIREAKRSARPELKDSLDWTRHNYYESFSLSPAAVADNVERADA |
Rabbit Polyclonal Anti-PTDSR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTDSR antibody: synthetic peptide directed towards the C terminal of human PTDSR. Synthetic peptide located within the following region: VVWHKTVRGRPKLSRKWYRILKQEHPELAVLADSVDLQESTGIASDSSSD |
Germany
Japan
United Kingdom
China