Rabbit Polyclonal Anti-SHB Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SHB antibody: synthetic peptide directed towards the N terminal of human SHB. Synthetic peptide located within the following region: ERPSQPPQAVPQASSAASASCGPATASCFSASSGSLPDDSGSTSDLIRAY |
Rabbit Polyclonal Anti-SHB Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SHB antibody: synthetic peptide directed towards the N terminal of human SHB. Synthetic peptide located within the following region: MAKWLNKYFSLGNSKTKSPPQPPRPDYREQRRRGERPSQPPQAVPQASSA |
Germany
Japan
United Kingdom
China