Rabbit Polyclonal Anti-NR1I2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NR1I2 antibody is: synthetic peptide directed towards the N-terminal region of Human NR1I2. Synthetic peptide located within the following region: AELASNHPRGPEANLEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVG |
Rabbit Polyclonal Anti-NR1I2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR1I2 antibody: synthetic peptide directed towards the N terminal of human NR1I2. Synthetic peptide located within the following region: MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATG |
Germany
Japan
United Kingdom
China