Antibodies for $/€ 289

Jump to Filters
View as table Download
ADAMTS19 Rabbit Polyclonal Antibody
TA345497

USD 475.00

5 Days

Rabbit Polyclonal Anti-ADAMTS19 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADAMTS19 antibody: synthetic peptide directed towards the N terminal of human ADAMTS19. Synthetic peptide located within the following region: MRLTHICCCCLLYQLGFLSNGIVSELQFAPDREEWEVVFPALWRREPVDP