Antibodies for $/€ 289

Jump to Filters
View as table Download
Kallikrein 2 (KLK2) Rabbit Polyclonal Antibody
TA346241

USD 475.00

5 Days

Rabbit Polyclonal Anti-KLK2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KLK2 antibody: synthetic peptide directed towards the middle region of human KLK2. Synthetic peptide located within the following region: KHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASG