Antibodies for $/€ 289

Jump to Filters
View as table Download
RNF113A Rabbit Polyclonal Antibody
TA343651

USD 475.00

5 Days

Rabbit Polyclonal Anti-RNF113A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNF113A antibody: synthetic peptide directed towards the middle region of human RNF113A. Synthetic peptide located within the following region: LQHFRTTPRCYVCDQQTNGVFNPAKELIAKLEKHRATGEGGASDLPEDPD