Antibodies for $/€ 289

Jump to Filters
View as table Download
MAP3K15 Rabbit Polyclonal Antibody
TA346678

USD 475.00

5 Days

Rabbit Polyclonal Anti-MAP3K15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAP3K15 antibody: synthetic peptide directed towards the C terminal of human MAP3K15. Synthetic peptide located within the following region: YQNLLRQTLEQKTQELYHLQLKLKSNCITENPAGPYGQRTDKELIDWLRL