USD 475.00
5 Days
Rabbit Polyclonal Anti-CNOT3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CNOT3 antibody: synthetic peptide directed towards the C terminal region of human CNOT3. Synthetic peptide located within the following region: MMWFQRHEEPKTITDEFEQGTYIYFDYEKWGQRKKEGFTFEYRYLEDRDL |
Rabbit Polyclonal Anti-CNOT6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CNOT6 antibody: synthetic peptide directed towards the N terminal of human CNOT6. Synthetic peptide located within the following region: EISGKVRSLSASLWSLTHLTALHLSDNSLSRIPSDIAKLHNLVYLDLSSN |
Rabbit Polyclonal Anti-PAPOLG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAPOLG antibody: synthetic peptide directed towards the middle region of human PAPOLG. Synthetic peptide located within the following region: SVDAIGGESMPIPTIDTSRKKRLPSKELPDSSSPVPANNIRVIKNSIRLT |
Rabbit Polyclonal Anti-DCP1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DCP1A antibody: synthetic peptide directed towards the N terminal of human DCP1A. Synthetic peptide located within the following region: MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDI |
Germany
Japan
United Kingdom
China