Antibodies for $/€ 289

Jump to Filters
View as table Download
KLF2 Rabbit Polyclonal Antibody
TA345198

USD 475.00

5 Days

Rabbit Polyclonal Anti-KLF2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-KLF2 antibody: synthetic peptide directed towards the middle region of human KLF2. Synthetic peptide located within the following region: NWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALHMKRH