Rabbit Polyclonal Anti-HDX Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HDX antibody: synthetic peptide directed towards the N terminal of human HDX. Synthetic peptide located within the following region: MNLRSVFTVEQQRILQRYYENGMTNQSKNCFQLILQCAQETKLDFSVVRT |
Rabbit Polyclonal Anti-HDX Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HDX antibody: synthetic peptide directed towards the middle region of human HDX. Synthetic peptide located within the following region: MKADDKEQQQALLSDLPPELEEMDFNHASLEPDDTSFSVSSLSEKNVSES |
Germany
Japan
United Kingdom
China