Antibodies for $/€ 289

View as table Download

Rabbit Polyclonal Anti-HIC2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HIC2 antibody: synthetic peptide directed towards the C terminal of human HIC2. Synthetic peptide located within the following region: FACDECGMRFTRQYRLTEHMRVHSGEKPYECQLCGGKFTQQRNLISHLRM

Rabbit Polyclonal Anti-HIC2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HIC2 antibody: synthetic peptide directed towards the N terminal of human HIC2. Synthetic peptide located within the following region: MVSGPLALRWCAWAGRGDMGPDMELPSHSKQLLLQLNQQRTKGFLCDVII