Rabbit Polyclonal Anti-HOXA11 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HOXA11 antibody: synthetic peptide directed towards the middle region of human HOXA11. Synthetic peptide located within the following region: FETAYGTPENLASSDYPGDKSAEKGPPAATATSAAAAAAATGAPATSSSD |
Rabbit Polyclonal Anti-HOXA11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HOXA11 antibody is: synthetic peptide directed towards the C-terminal region of Human HOXA11. Synthetic peptide located within the following region: FFSVYINKEKRLQLSRMLNLTDRQVKIWFQNRRMKEKKINRDRLQYYSAN |
Germany
Japan
United Kingdom
China