Antibodies for $/€ 289

Jump to Filters
View as table Download
KHSRP Rabbit Polyclonal Antibody
TA345846

USD 475.00

5 Days

Rabbit Polyclonal Anti-KHSRP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-KHSRP antibody is: synthetic peptide directed towards the middle region of Human KHSRP. Synthetic peptide located within the following region: WEEYYKKQAQVATGGGPGAPPGSQPDYSAAWAEYYRQQAAYYGQTPGPGG
KHSRP Rabbit Polyclonal Antibody
TA345845

USD 475.00

5 Days

Rabbit Polyclonal Anti-KHSRP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-KHSRP antibody is: synthetic peptide directed towards the middle region of Human KHSRP. Synthetic peptide located within the following region: IIGDPYKVQQACEMVMDILRERDQGGFGDRNEYGSRIGGGIDVPVPRHSV