Antibodies for $/€ 289

Jump to Filters
View as table Download
NARG1L (NAA16) Rabbit Polyclonal Antibody
TA346823

USD 475.00

5 Days

Rabbit Polyclonal Anti-NARG1L Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NARG1L antibody: synthetic peptide directed towards the middle region of human NARG1L. Synthetic peptide located within the following region: ASLKTCDFFSPYENGEKEPPTTLLWVQYFLAQHFDKLGQYSLALDYINAA
NARG1L (NAA16) Rabbit Polyclonal Antibody
TA346824

USD 475.00

5 Days

Rabbit Polyclonal Anti-NARG1L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NARG1L antibody: synthetic peptide directed towards the middle region of human NARG1L. Synthetic peptide located within the following region: RKGKFLLMLQSVKRAFAINSNNPWLHECLIRFSKSVSNHSNLPDIVSKVL