Rabbit Polyclonal Anti-STAU2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-STAU2 antibody is: synthetic peptide directed towards the C-terminal region of Human STAU2. Synthetic peptide located within the following region: AMLLQLGYKASTNLQDQLEKTGENKGWSGPKPGFPEPTNNTPKGILHLSP |
Rabbit Polyclonal Anti-STAU2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-STAU2 antibody is: synthetic peptide directed towards the C-terminal region of Human STAU2. Synthetic peptide located within the following region: STNLQDQLEKTGENKGWSGPKPGFPEPTNNTPKGILHLSPDVYQEMEASR |
Germany
Japan
United Kingdom
China