Rabbit Polyclonal Anti-OR10X1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR10X1 antibody: synthetic peptide directed towards the middle region of human OR10X1. Synthetic peptide located within the following region: NIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSYHAHP |
Rabbit Polyclonal Anti-OR5T2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR5T2 antibody: synthetic peptide directed towards the C terminal of human OR5T2. Synthetic peptide located within the following region: DMIVSIFYTIVIPLLNPVIYSLRNKDVKDSMKKMFGKNQVINKVYFHTKK |
Germany
Japan
United Kingdom
China