Antibodies for $/€ 289

Jump to Filters
View as table Download
AIF (AIFM1) Rabbit Polyclonal Antibody
TA345681

USD 475.00

5 Days

Rabbit Polyclonal Anti-PDCD8 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PDCD8 antibody: synthetic peptide directed towards the C terminal of human PDCD8. Synthetic peptide located within the following region: VDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPST