Antibodies for $/€ 289

Jump to Filters
View as table Download
ANK1 Rabbit Polyclonal Antibody
TA346151

USD 475.00

5 Days

Rabbit Polyclonal Anti-ANK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANK1 antibody: synthetic peptide directed towards the middle region of human ANK1. Synthetic peptide located within the following region: PCAMPETVVIRSEEQEQASKEYDEDSLIPSSPATETSDNISPVASPVHTG