Antibodies for $/€ 289

Jump to Filters
View as table Download
IL28 Receptor alpha (IFNLR1) Rabbit Polyclonal Antibody
TA346514

USD 475.00

5 Days

Rabbit Polyclonal Anti-IL28RA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL28RA antibody: synthetic peptide directed towards the N terminal of human IL28RA. Synthetic peptide located within the following region: QDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRV