Antibodies for $/€ 289

Jump to Filters
View as table Download
IL18R Beta (IL18RAP) Rabbit Polyclonal Antibody
TA346368

USD 410.00

5 Days

Rabbit Polyclonal Anti-IL18RAP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL18RAP antibody: synthetic peptide directed towards the N terminal of human IL18RAP. Synthetic peptide located within the following region: NRLSPKQVPEHLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKC