Antibodies for $/€ 289

Jump to Filters
View as table Download
LAMP3 Rabbit Polyclonal Antibody
TA346129

USD 475.00

5 Days

Rabbit Polyclonal Anti-LAMP3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LAMP3 antibody: synthetic peptide directed towards the N terminal of human LAMP3. Synthetic peptide located within the following region: YSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPT