Antibodies for $/€ 289

View as table Download

Rabbit Polyclonal Anti-PH-4 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PH-4 antibody: synthetic peptide directed towards the middle region of human PH-4. Synthetic peptide located within the following region: GHYHAHVDSGPVYPETICSHTKLVANESVPFETSCRYMTVLFYLNNVTGG

Rabbit Polyclonal Anti-PH-4 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PH-4 antibody: synthetic peptide directed towards the middle region of human PH-4. Synthetic peptide located within the following region: RLGNGWWMTPESIQEMYAAIKADPDGDGVLSLQEFSNMDLRDFHKYMRSH