Rabbit Polyclonal Anti-TMCC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMCC2 antibody: synthetic peptide directed towards the N terminal of human TMCC2. Synthetic peptide located within the following region: GETTGANSAGGPTSDAGAAAAPNPGPRSKPPDLKKIQQLSEGSMFGHGLK |
Rabbit Polyclonal Anti-TMCC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TMCC2 antibody is: synthetic peptide directed towards the middle region of Human TMCC2. Synthetic peptide located within the following region: KVDKGDLVALSLPAGHGDTDGPISLDVPDGAPDPQRTKAAIDHLHQKILK |
Germany
Japan
United Kingdom
China