Antibodies for $/€ 289

Jump to Filters
View as table Download
C11orf73 (HIKESHI) Rabbit Polyclonal Antibody
TA345028

USD 475.00

5 Days

Rabbit Polyclonal Anti-C11orf73 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C11orf73 antibody: synthetic peptide directed towards the middle region of human C11orf73. Synthetic peptide located within the following region: DNFYNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWK