Antibodies for $/€ 289

Jump to Filters
View as table Download
Bcl11a Rabbit Polyclonal Antibody
TA345369

USD 475.00

5 Days

Rabbit Polyclonal Anti-Bcl11a Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Bcl11a antibody is: synthetic peptide directed towards the N-terminal region of Rat Bcl11a. Synthetic peptide located within the following region: KREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDILIF