Antibodies for $/€ 289

Jump to Filters
View as table Download
Mbnl2 Rabbit Polyclonal Antibody
TA343902

USD 475.00

5 Days

Rabbit Polyclonal Anti-Mbnl2 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Mbnl2 antibody is: synthetic peptide directed towards the middle region of RAT Mbnl2. Synthetic peptide located within the following region: IACFDSLKGRCSRENCKYLHPPTHLKTQLEINGRNNLIQQKTAAAMLAQQ