Antibodies for $/€ 289

Jump to Filters
View as table Download
Racgap1 Rabbit Polyclonal Antibody
TA343711

USD 475.00

5 Days

Rabbit Polyclonal Anti-Racgap1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Racgap1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Racgap1. Synthetic peptide located within the following region: GPVTTPEFQLVKTPSSNSLSQRLYNLSKSTPRFGNKSKSATNLGQQGKFF