Antibodies for $/€ 289

Jump to Filters
View as table Download
Rtca Rabbit Polyclonal Antibody
TA345849

USD 475.00

5 Days

Rabbit Polyclonal Anti-Rtcd1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Rtcd1 antibody is: synthetic peptide directed towards the middle region of Rat Rtcd1. Synthetic peptide located within the following region: QHLSGLEMVRDLCDGHLEGAEIGSTEITFTPEKIRGGVHTADTKTAGSVC