Rabbit Polyclonal Anti-C11orf73 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C11orf73 antibody: synthetic peptide directed towards the middle region of human C11orf73. Synthetic peptide located within the following region: DNFYNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWK |
Rabbit Polyclonal Anti-C11orf73 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-l7Rn6 antibody is: synthetic peptide directed towards the N-terminal region of Rat l7Rn6. Synthetic peptide located within the following region: GKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSLAQQT |
Germany
Japan
United Kingdom
China