Rabbit Polyclonal Anti-MRPL24 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MRPL24 antibody: synthetic peptide directed towards the N terminal of human MRPL24. Synthetic peptide located within the following region: RRRPVVVEPISDEDWYLFCGDTVEILEGKDAGKQGKVVQVIRQRNWVVVG |
Rabbit Polyclonal Anti-mrpl24 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-mrpl24 antibody is: synthetic peptide directed towards the C-terminal region of Rat mrpl24. Synthetic peptide located within the following region: GIVPETWTDGPKDTSVEDALERTYVPRLKTLEEDVMEAMGIQETRRFKKI |
Germany
Japan
United Kingdom
China