Antibodies for $/€ 289

View as table Download

Rabbit Polyclonal Anti-SEP15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SEP15 antibody: synthetic peptide directed towards the middle region of human SEP15. Synthetic peptide located within the following region: SDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLS

Rabbit Polyclonal Anti-sep15 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-sep15 antibody is: synthetic peptide directed towards the C-terminal region of Rat sep15. Synthetic peptide located within the following region: LFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLSEKLER